Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Adrenomedullin (22-52) (human) trifluoroacetate salt
H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt

H-4144

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4144.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 258.00
CHF 239.94 (7%)
H-4144.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 464.00
CHF 431.52 (7%)
Add to Wish List
Add to Compare

Details

This compound is a putative adrenomedullin receptor antagonist that inhibits the production of cAMP elicted by adrenomedullin. It is a more effective antagonist for adrenomedullin- and CGRP-specific receptors than α-CGRP (8-37) (human) (H-9895).
Item Number 4028071
APC Number 22-1-16
One Letter Code TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂
Molecular Formula C₁₅₉H₂₅₂N₄₆O₄₈
Relative Molecular Mass 3576.03
CAS Registry Number [159899-65-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C

H-4144

Enzyme Substrates Inhibitors
Ca²⁺/Calmodulin-Dependent Protein Kinase