Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (42-1)
H-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH

H-3976

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-3976.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 325.00
CHF 302.25 (7%)
H-3976.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 577.00
CHF 536.61 (7%)
Add to Wish List
Add to Compare

Details

Reverse sequence of Aβ 1-42 (H-1386, H-6466), inactive control for the Aβ.
Item Number 4027991
APC Number 62-0-81
One Letter Code AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Synonyms β-Amyloid (42-1)
Molecular Formula C₂₀₃H₃₁₁N₅₅O₆₀S
Relative Molecular Mass 4514.10
CAS Registry Number [317366-82-8]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease

Bachem product citations

M.Jayalal L .P, J. Chosun Nat. Sci., 6, 143 (2013)