Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Exendin-4 (3-39)
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂

H-3864

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-3864.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 285.00
CHF 265.05 (7%)
H-3864.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 490.00
CHF 455.70 (7%)
Add to Wish List
Add to Compare

Details

Potent glucagon-like peptide 1 (GLP-1) receptor antagonist.
Item Number 4027457
APC Number 46-3-05
One Letter Code EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Molecular Formula C₁₇₆H₂₇₂N₄₆O₅₈S
Relative Molecular Mass 3992.44
CAS Registry Number [196109-31-6]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords GLP-1 antagonist
Areas of Interest Diabetes