Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

VIP (human, mouse, rat) acetate salt
H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ acetate salt

H-3775

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-3775.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 124.00
CHF 115.32 (7%)
H-3775.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 494.00
CHF 459.42 (7%)
Add to Wish List
Add to Compare

Details

VIP, a 28-amino acid peptide belonging to the secretin-glucagon-CRF family, is widely distributed in the central and peripheral nervous systems. Acting both as a neurotransmitter and as a hormone, VIP is involved in a wide variety of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretion. An injectable formulation of this peptide in combination with the adrenergic drug phentolamine is expected to provide a new and effective alternative for erectile dysfunction patients.
Item Number 4011611
APC Number 48-1-10
One Letter Code HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Synonyms Aviptadil, VIP, human, porcine, rat, ovine
Molecular Formula C₁₄₇H₂₃₈N₄₄O₄₂S
Relative Molecular Mass 3325.84
CAS Registry Number [40077-57-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C

Bachem product citations

R.C.Shoemaker et al., Health Manag. Technol., 5, 396 (2013)