Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: Out of stock

rec Endothelial IL-8 (human)
H-Ala-Val-Leu-Pro-Arg-Ser-Ala-Lys-Glu-Leu-Arg-Cys-Gln-Cys-Ile-Lys-Thr-Tyr-Ser-Lys-Pro-Phe-His-Pro-Lys-Phe-Ile-Lys-Glu-Leu-Arg-Val-Ile-Glu-Ser-Gly-Pro-His-Cys-Ala-Asn-Thr-Glu-Ile-Ile-Val-Lys-Leu-Ser-Asp-Gly-Arg-Glu-Leu-Cys-Leu-Asp-Pro-Lys-Glu-Asn-Trp-Val-Gln-Arg-Val-Val-Glu-Lys-Phe-Leu-Lys-Arg-Ala-Glu-Asn-Ser-OH
(Disulfide bonds between Cys¹² and Cys³⁹/Cys¹⁴ and Cys⁵⁵)

H-3742

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price
H-3742.0010 10 µg Request lead time  
CHF 216.00
CHF 200.88 (7%)
H-3742.0050 50 µg Request lead time  
CHF 803.00
CHF 746.79 (7%)

Details

Endothelial IL8 contains 77 amino acids and is fully active in chemotaxis and degranulation. The ED₅₀ as determined by the stimulation of elastase release from cytochalasin B-treated neutrophils is 10 ng/mL.
Item Number 4030791
One Letter Code AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Synonyms rec Endothelial Interleukin-8 (human), Neutrophil Chemotactic Factor (human isoform), CXCL8
Molecular Formula C₃₉₇H₆₄₄N₁₁₄O₁₁₁S₄
Relative Molecular Mass 8918.45
CAS Registry Number [142298-01-9]
Source Recombinant
Storage Conditions -20 ± 5 °C
Keywords Recombinant protein