Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

PHI-27 (porcine)
H-His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Arg-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH₂

H-3730

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-3730.0500 0.5 mg Ships within 3-5 business days  
CHF 258.00
CHF 239.94 (7%)
H-3730.1000 1 mg Ships within 3-5 business days  
CHF 412.00
CHF 383.16 (7%)
Add to Wish List
Add to Compare

Details

Porcine intestinal peptide which belongs to the glucagon-secretin family. It exhibits biological activities similar to vasoactive intestinal peptide (VIP) and secretin.
Item Number 4031154
APC Number 48-4-10
One Letter Code HADGVFTSDFSRLLGQLSAKKYLESLI-NH₂
Synonyms PHI (PHI-27), porcine
Molecular Formula C₁₃₆H₂₁₆N₃₆O₄₀
Relative Molecular Mass 2995.43
CAS Registry Number [80458-29-3]
Source Synthetic
Storage Conditions -20 ± 5 °C