Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Leptin (138-167) (human)
H-Ser-Gly-Tyr-Ser-Thr-Glu-Val-Val-Ala-Leu-Ser-Arg-Leu-Gln-Gly-Ser-Leu-Gln-Asp-Met-Leu-Trp-Gln-Leu-Asp-Leu-Ser-Pro-Gly-Cys-OH

H-3428

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-3428.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 577.00
CHF 536.61 (7%)
H-3428.1000 1 mg Ships within 3-5 business days  
CHF 1'030.00
CHF 957.90 (7%)
Add to Wish List
Add to Compare
Item Number 4026673
One Letter Code SGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Synonyms Obese Gene Peptide (138-167) (human)
Molecular Formula C₁₄₁H₂₂₄N₃₇O₄₇S₂
Relative Molecular Mass 3253.69
CAS Registry Number [313338-97-5]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Obesity Research