Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Cecropin A
H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH₂

H-3094

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-3094.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 108.00
CHF 100.44 (7%)
H-3094.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 184.00
CHF 171.12 (7%)
Add to Wish List
Add to Compare

Details

Cecropin A is a 37-residue peptide with antibacterial activity against Escherichia coli, Pseudomonas aeruginosa, Bacillus megaterium and Micrococcus luteus, at micromolar concentrations.
Item Number 4030488
APC Number 87-9-59
One Letter Code KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH₂
Synonyms Cecropin A, porcine
Molecular Formula C₁₈₄H₃₁₃N₅₃O₄₆
Relative Molecular Mass 4003.84
CAS Registry Number [80451-04-3]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antimicrobial peptide