Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Calcitonin (chicken) trifluoroacetate salt
H-Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH₂ trifluoroacetate salt
(Disulfide bond)

H-3074

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-3074.0001 1 mg Ships within 3-5 business days  
CHF 175.00
CHF 162.75 (7%)
H-3074.0005 5 mg Ships within 3-5 business days  
CHF 700.00
CHF 651.00 (7%)
Add to Wish List
Add to Compare
Item Number 4030323
APC Number 22-7-12
One Letter Code CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH₂
Molecular Formula C₁₄₅H₂₄₀N₄₂O₄₆S₂
Relative Molecular Mass 3371.89
CAS Registry Number [100016-62-4]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Osteoporosis Research

Product citations

T.Kurihara et al., Peptide Chemistry 1985, Proceedings of the 23rd Symposium, Kyoto, p. 173, Y.Kiso, ed., Protein Res. Foundation, Osaka, (1986)