Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (40-1) trifluoroacetate salt
H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt

H-2972

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2972.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 129.00
CHF 119.97 (7%)
H-2972.1000 1 mg Ships within 3-5 business days  
CHF 215.00
CHF 199.95 (7%)
Add to Wish List
Add to Compare

Details

Reverse sequence of Aβ 1-40. Inactive control for H-1194 and H-5568.
Item Number 4030203
One Letter Code VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Synonyms β-Amyloid (40-1)
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number [144409-99-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease