Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-38) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH trifluoroacetate salt

H-2966

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2966.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 109.00
CHF 101.37 (7%)
H-2966.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 201.00
CHF 186.93 (7%)
Add to Wish List
Add to Compare

Details

Like Aβ (25-35) (H-1192), the Aβ fragment (1-38) destabilizes calcium homeostasis and renders human cortical neurones vulnerable to environmental insults.
Item Number 4030204
APC Number 62-0-76
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Formula C₁₈₄H₂₇₇N₅₁O₅₆S
Relative Molecular Mass 4131.60
CAS Registry Number [131438-74-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease