Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

BNP-32 (porcine) trifluoroacetate salt
H-Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH trifluoroacetate salt
(Disulfide bond)

H-2952

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2952.0500 0.5 mg Ships within 3-5 business days  
CHF 216.00
CHF 200.88 (7%)
H-2952.1000 1 mg Ships within 3-5 business days  
CHF 402.00
CHF 373.86 (7%)
Add to Wish List
Add to Compare
Item Number 4030321
APC Number 14-4-11
One Letter Code SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY
Synonyms Brain Natriuretic Peptide-32 (porcine), BNP (1-32), porcine
Molecular Formula C₁₄₉H₂₅₀N₅₂O₄₄S₃
Relative Molecular Mass 3570.15
CAS Registry Number [117345-87-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Regenerative Medicine