Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Adrenomedullin (rat) trifluoroacetate salt
H-Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt
(Disulfide bond)

H-2934

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2934.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 474.00
CHF 440.82 (7%)
H-2934.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 793.00
CHF 737.49 (7%)
Add to Wish List
Add to Compare

Details

Synthetic rat adrenomedullin (rADM) elicits a potent and longlasting hypotensive activity in anesthesized rats.
Item Number 4030175
APC Number 22-8-10
One Letter Code YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH₂
Synonyms ADM (1-50) (rat), Adrenomedullin (1-50), rat
Molecular Formula C₂₄₂H₃₈₁N₇₇O₇₅S₅
Relative Molecular Mass 5729.49
CAS Registry Number [161383-47-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone