Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Adrenomedullin (human) trifluoroacetate salt
H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt
(Disulfide bond)

H-2932

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2932.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 474.00
CHF 440.82 (7%)
H-2932.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 793.00
CHF 737.49 (7%)
Add to Wish List
Add to Compare

Details

Adrenomedullin (ADM) elicits a potent and longlasting hypotensive effect and is considered as a hormone involved in blood pressure control. Additionally, ADM acts as a protective factor of blood vessels.
Adrenomedullin is a potent stimulator of osteoblastic activity. Further biological activities of hADM include reduction of oxidative stress and inhibition of endothelial cell apoptosis.
Item Number 4030315
APC Number 22-2-10
One Letter Code YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂
Synonyms ADM (1-52) (human), Adrenomedullin (1-52), human
Molecular Formula C₂₆₄H₄₀₆N₈₀O₇₇S₃
Relative Molecular Mass 6028.82
CAS Registry Number [148498-78-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone