Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amylin (8-37) (mouse, rat)
H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂

H-2746

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2746.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 185.00
CHF 172.05 (7%)
H-2746.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 319.00
CHF 296.67 (7%)
Add to Wish List
Add to Compare

Details

The effect of IAPP (8-37) (mouse, rat), an amylin receptor antagonist, on the ANP release was attenuated in streptozotocin-treated rats.
Item Number 4030346
APC Number 74-5-13
One Letter Code ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH₂
Molecular Formula C₁₄₀H₂₂₇N₄₃O₄₃
Relative Molecular Mass 3200.61
CAS Registry Number [138398-61-5]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords IAPP antagonist
Areas of Interest Diabetes