Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt

H-2734

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2734.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 258.00
CHF 239.94 (7%)
H-2734.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 433.00
CHF 402.69 (7%)
Add to Wish List
Add to Compare

Details

The PACAP selective antagonist PACAP (6-38) is a potent and selective inhibitor of PACAP-27-stimulated pituitary adenylate cyclase with a Ki values of 150 nM.
Item Number 4031158
APC Number 34-0-19
One Letter Code FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Synonyms Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
Molecular Formula C₁₈₂H₃₀₀N₅₆O₄₅S
Relative Molecular Mass 4024.80
CAS Registry Number [143748-18-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C

H-2734

Enzyme Substrates Inhibitors
Adenylate Cyclase