Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Stichodactyla helianthus Neurotoxin (ShK) trifluoroacetate salt
H-Arg-Ser-Cys-Ile-Asp-Thr-Ile-Pro-Lys-Ser-Arg-Cys-Thr-Ala-Phe-Gln-Cys-Lys-His-Ser-Met-Lys-Tyr-Arg-Leu-Ser-Phe-Cys-Arg-Lys-Thr-Cys-Gly-Thr-Cys-OH trifluoroacetate salt
(Disulfide bonds between Cys³ and Cys³⁵/Cys¹² and Cys²⁸/Cys¹⁷ and Cys³²)

H-2358

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2358.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 232.00
CHF 215.76 (7%)
H-2358.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 927.00
CHF 862.11 (7%)
H-2358.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'545.00
CHF 1'436.85 (7%)
Add to Wish List
Add to Compare

Details

ShK-toxin, originally isolated from the sea anemone Stichodactyla helianthus, has been found to inhibit the specific binding of dendrotoxin I to rat brain membranes. Due to its unique structure (it contains three intramolecular disulfide bridges) and high affinity for some potassium channels, ShK-toxin may become a useful molecular probe for investigating potassium channels.
Item Number 4031286
One Letter Code RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
Synonyms ShK
Molecular Formula C₁₆₉H₂₇₄N₅₄O₄₈S₇
Relative Molecular Mass 4054.83
CAS Registry Number [172450-46-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Ion Channel Modulating Agents

Product citations

M.W.Pennington et al., A Guidebook to Protein Toxins and their Use in Cell Biology, p. 159, C.Montecucco and R.Rappuoli, eds., Oxford University Press, (1997)
M.W.Pennington et al., Peptides: Chemistry, Structure and Biology, p. 192, P.T.P.Kaumaya and R.S.Hodges, eds., Mayflower Scientific Ltd., (1996)
W.R.Kem et al., Lett. Pept. Sci., 3, 69 (1996)
J.Pohl et al., Lett. Pept. Sci., 1, 291 (1994)