Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

pTH (1-31) (human)
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-OH

H-2274

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2274.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 690.00
CHF 641.70 (7%)
H-2274.1000 1 mg Ships within 3-5 business days  
CHF 1'236.00
CHF 1'149.48 (7%)
Add to Wish List
Add to Compare

Details

This pTH fragment stimulates adenylyl cyclase in ROS 17/2 rat osteosarcoma cells as strongly as pTH (1-34) (H-4835). However unlike pTH (1-34) it does not stimulate membrane-associated protein kinase C.
Item Number 4025809
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV
Molecular Formula C₁₆₂H₂₆₉N₄₉O₄₇S₂
Relative Molecular Mass 3719.35
CAS Registry Number [157938-23-3]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cancer Research