Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Calcitonin (human) trifluoroacetate salt
H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH₂ trifluoroacetate salt
(Disulfide bond)

H-2250

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-2250.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 165.00
CHF 153.45 (7%)
H-2250.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 659.00
CHF 612.87 (7%)
Add to Wish List
Add to Compare

Details

Calcitonin is a peptide hormone involved in calcium and phosphorus homeostasis. Its inhibitory effect on osteoclast activity lowers blood calcium levels and positively influences bone mass density.
Item Number 4014409
APC Number 22-1-10
One Letter Code CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH₂
Molecular Formula C₁₅₁H₂₂₆N₄₀O₄₅S₃
Relative Molecular Mass 3417.90
CAS Registry Number [21215-62-3] net
EINECS Number 244-276-2
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Regulator of calcium and phosphorus homeostasis
Areas of Interest Osteoporosis Research