Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GRP (porcine)
H-Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH₂

H-1635

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-1635.0500 0.5 mg Ships within 3-5 business days  
CHF 206.00
CHF 191.58 (7%)
H-1635.1000 1 mg Ships within 3-5 business days  
CHF 361.00
CHF 335.73 (7%)
Add to Wish List
Add to Compare
Item Number 4011672
APC Number 46-4-40
One Letter Code APVSVGGGTVLAKMYPRGNHWAVGHLM-NH₂
Synonyms Gastrin Releasing Peptide, porcine
Molecular Formula C₁₂₆H₁₉₈N₃₈O₃₁S₂
Relative Molecular Mass 2805.33
CAS Registry Number [74815-57-9]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Gastrointestinal Research