Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Pancreatic Polypeptide (human) trifluoroacetate salt
H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH₂ trifluoroacetate salt

H-1610

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-1610.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 258.00
CHF 239.94 (7%)
H-1610.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 464.00
CHF 431.52 (7%)
Add to Wish List
Add to Compare

Details

As antagonist of CCK, PP inhibits pancreatic sedretion. PP also acts on the gastrointestinal motility, food intake, and metabolism.
Item Number 4015101
APC Number 46-1-69
One Letter Code APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH₂
Molecular Formula C₁₈₅H₂₈₇N₅₃O₅₄S₂
Relative Molecular Mass 4181.77
CAS Registry Number [75976-10-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C