Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-43)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-OH

H-1586

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-1586.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 325.00
CHF 302.25 (7%)
H-1586.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 541.00
CHF 503.13 (7%)
Add to Wish List
Add to Compare

Details

The amyloid β-protein is a 39- to 43-amino acid polypeptide that is the primary constituent of senile plaques and cerebrovascular deposits in Alzheimer's disease and Down's syndrome. Additionally it acts as an inhibitor of the ubiquitin-dependent protein degradation in vitro.
Item Number 4018358
APC Number 62-0-83
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Synonyms β-Amyloid (1-43)
Molecular Formula C₂₀₇H₃₁₈N₅₆O₆₂S
Relative Molecular Mass 4615.21
CAS Registry Number [134500-80-4]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease