Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

IL-6 (88-121) (human)
H-Ile-Ile-Thr-Gly-Leu-Leu-Glu-Phe-Glu-Val-Tyr-Leu-Glu-Tyr-Leu-Gln-Asn-Arg-Phe-Glu-Ser-Ser-Glu-Glu-Gln-Ala-Arg-Ala-Val-Gln-Met-Ser-Thr-Lys-OH

H-1398

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-1398.0500 0.5 mg Ships within 3-5 business days  
CHF 420.00
CHF 390.60 (7%)
H-1398.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 735.00
CHF 683.55 (7%)
Add to Wish List
Add to Compare

Details

IL-6 (88-121) competitively inhibits the binding of human IL-6 to its receptor by interacting with the IL-6 receptor to a significant degree. It is suggested that this peptide comprises a part of the receptor-binding region of IL-6.
Item Number 4025280
One Letter Code IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK
Synonyms Interleukin-6 (88-121) (human)
Molecular Formula C₁₇₉H₂₈₁N₄₅O₅₈S
Relative Molecular Mass 4023.53
CAS Registry Number [145990-81-4]
Source Synthetic
Storage Conditions -20 ± 5 °C