Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

ACTH (7-38) (human)
H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH

H-1205

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-1205.0500 0.5 mg Ships within 3-5 business days  
CHF 124.00
CHF 115.32 (7%)
H-1205.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 206.00
CHF 191.58 (7%)
Add to Wish List
Add to Compare
Item Number 4015541
APC Number 10-1-30
One Letter Code FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Synonyms Corticotropin-Inhibiting Peptide (CIP)
Molecular Formula C₁₆₇H₂₅₇N₄₇O₄₆
Relative Molecular Mass 3659.17
CAS Registry Number [68563-24-6]
Source Synthetic
Storage Conditions -20 ± 5 °C