Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-1194

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-1194.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 90.00
CHF 83.70 (7%)
H-1194.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 236.00
CHF 219.48 (7%)
H-1194.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 395.00
CHF 367.35 (7%)
H-1194.5000 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'295.00
CHF 1'204.35 (7%)
Add to Wish List
Add to Compare

Details

Amyloid β-peptide (1-40) showed both neurotrophic and neurotoxic effects in dependence on the neuronal age and the concentration of the β-protein. Aβ 1-40 has been used as well as Aβ 1-42 to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients. The sequence of H-1194 corresponds to the human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ40 peptide. Besides the TFA salt, Bachem offers the HCl salt of the peptide (H-5568). H-2972, the inverted sequence, can be used as inactive control in experiments employing Aβ 1-40.
For detailed descriptions of the preparation of wild-type and mutant Aβ 1-40 monomers and protofibrils please see the paper of Jan, Hartley, and Lashuel.
Item Number 4014442
APC Number 62-0-78
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Aβ40 trifluoroacetate salt, β-Amyloid (1-40)
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number [131438-79-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease

Bachem product citations